131388-HRP
PKD2 (Polycystin-2, Autosomal Dominant Polycystic Kidney Disease Type II Protein, Polycystic Kidney Disease 2 Protein, Polycystwin, R48321) (HRP)
Größe
£914.00
- SKU:
- 131388-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa261-360 from human PKD2 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4C8
- Format:
- Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with horseradish peroxidase (HRP).
- Weitere Details:
- Protein kinase D (PKD), a serine/threonine kinase originally described as a novel PKC family member and termed PKCm, belongs to the calcium calmodulin superfamily of kinases. Three mammalian isoforms have so far been described - PKD1/PKCu, PKD2 and PKD3/PKCν; these isoforms show a high degree of homology, especially in their catalytic domain. PKDs are major targets for tumor promoting phorbol esters; they are activated via G protein-coupled receptors (GPCRs) and their activation is also dependent on PKC activation. PKDs have been implicated in numerous cellular functions, including signal transduction as well as cell survival, migration, differentiation, and proliferation. They are important regulators of secretory transport at the trans- golgi network. Of the three isoforms, PKD1 is the best characterized. It is involved in the regulation of Golgi function, cell proliferation and apoptosis and it mediates oxidative stress signaling regulating cellular detoxification and survival. PKD2 has been found to phosphorylate histone H1 more efficiently than aldolase in vitro. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: PVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice