131354-BIOTIN
PIN4 (Peptidyl-prolyl Cis-trans Isomerase NIMA-interacting 4, Peptidyl-prolyl Cis-trans Isomerase Pin4, PPIase Pin4, Rotamase Pin4, Parvulin-14, Par14, Parvulin-17, Par17, Peptidyl-prolyl Cis/trans Isomerase EPVH, hEPVH) (Biotin)
Größe
£934.00
- SKU:
- 131354-BIOTIN
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human PIN4, aa1-156 (NP_006214.2).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- PIN4, also known as Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4, is peptidyl-prolyl cis/trans isomerase (PPIase) that interacts with NIMA and is essential for cell cycle regulation. There are two different isoforms which are PAR14 and PAR17. PIN4/PAR17 was imported into mitochondria in a time and membrane potential-dependent manner, where it reached the mitochondrial matrix. Moreover, Pin4 protein was shown to bind to double-stranded DNA under physiological salt conditions. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice