PIM1 (PIM-1, Oncogene PIM1, Oncogene PIM-1, Pim1 Kinase, Pim-1 Kinase, Pim1 Oncogene, Pim-1 Oncogene, PIM, Proto-oncogene Serine/threonine-protein Kinase Pim-1, Proto-oncogene Serine/threonine Protein Kinase Pim1)

Größe

£685.00

SKU:: 131351
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-100 from human PIM1 (AAH20224) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2C9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: PIM1, which belongs to the Serine/Threonine protein kinase family, is thought to play a role in signal transduction in blood cells. The protooncogene PIM1 encodes a protein kinase upregulated in prostate cancer. It may affect the structure or silencing of chromatin by phosphorylating HP1 gamma/CBX3. PIM1 is expressed primarily in cells of the hematopoietic and germ line lineages. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.