PIK3R3 (Phosphatidylinositol 3-kinase Regulatory Subunit gamma, PI3-kinase Regulatory Subunit gamma, PI3K Regulatory Subunit gamma, PtdIns-3-kinase Regulatory Subunit gamma, Phosphatidylinositol 3-kinase 55kD Regulatory Subunit gamma, PI3-kinase Subunit p55-gamma, PtdIns-3-kinase Regulatory Subunit p55-gamma, p55PIK, DKFZp686P05226, FLJ41892)

Größe

£685.00

SKU:: 131347
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa271-381 from PIK3R3 (AAH21622) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2F8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During insulin stimulation, it also binds to IRS-1. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HDSKMRLEQDLKNQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAF* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.