131347-HRP
PIK3R3 (Phosphatidylinositol 3-kinase Regulatory Subunit gamma, PI3-kinase Regulatory Subunit gamma, PI3K Regulatory Subunit gamma, PtdIns-3-kinase Regulatory Subunit gamma, Phosphatidylinositol 3-kinase 55kD Regulatory Subunit gamma, PI3-kinase Subunit p55-gamma, PtdIns-3-kinase Regulatory Subunit p55-gamma, p55PIK, DKFZp686P05226, FLJ41892) (HRP)
Größe
£914.00
- SKU:
- 131347-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa271-381 from PIK3R3 (AAH21622) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2F8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Weitere Details:
- Binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During insulin stimulation, it also binds to IRS-1. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HDSKMRLEQDLKNQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAF* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice