131341-BIOTIN
PIK3CA (Phosphatidylinositol-4,5-bisphosphate 3-kinase Catalytic Subunit alpha Isoform, PtdIns-3-kinase Subunit alpha, PI3-kinase Subunit alpha, PI3K-alpha, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110kD Catalytic Subunit alpha, PtdIns-3-kinase Subunit p110-alpha, MGC142161, MGC142163) (Biotin)
Größe
£914.00
- SKU:
- 131341-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa959-1069 from human PIK3CA (NP_006209) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3G3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Phosphatidylinositol 3-kinase is composed of an 85kD regulatory subunit and a 110kD catalytic subunit. The protein encoded by this gene represents the catalytic subunit, which uses ATP to phosphorylate PtdIns, PtdIns4P and PtdIns(4,5)P2. This gene has been found to be oncogenic and has been implicated in cervical cancers. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice