PIK3AP1 (BCAP, Phosphoinositide 3-kinase Adapter Protein 1, B Cell Adapter for Phosphoinositide 3-kinase, B Cell Phosphoinositide 3-kinase Adapter Protein 1)

Größe

£685.00

SKU:: 131336
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa601-701 from human PIK3AP1 (NP_689522) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3C2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: PIK3AP1 is involved in the activation of phosphoinositide 3-kinase (PI3K) in B-cells and in natural killer (NK) cells. Couples B-cell antigen receptor (BCR) to PI3K activation by providing a docking site for the PI3K subunit PIK3R1, which contributes to B-cell development. Seems to have a complementary role with CD19 in PI3K activation (By similarity). May be involved in the survival of mature B cells via activation of REL (By similarity). Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KTPGQRQLITLQEQVKLGIVNVDEAVLHFKEWQLNQKKRSESFRFQQENLKRLRDSITRRQREKQKSGKQTDLEITVPIRHSQHLPAKVEFGVYESGPRK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.