PIGQ (Phosphatidylinositol N-acetylglucosaminyltransferase Subunit Q, N-acetylglucosamyl Transferase Component GPI1, Phosphatidylinositol-glycan Biosynthesis Class Q Protein, PIG-Q, GPI1, c407A10.1, hGPI1, MGC12693)

Größe

£685.00

SKU:: 131328
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa661-759 from PIGQ (NP_683721) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis. Applications: Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 4ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: HCPMPTLCTQVQRVRPPQQPQVEGWSPWGLPSGSALAVGVEGPCQDEPPSPRHPLAPSAEQHPASGGLKQSLTPVPSGPGPSLPEPHGVYLRMFPGEV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.