131309-BIOTIN
PIAS1 (E3 SUMO-protein Ligase PIAS1, Protein Inhibitor of Activated STAT Protein 1, Gu Binding Protein, GBP, RNA Helicase II Binding Protein, DEAD/H Box-binding Protein 1, DDXBP1, MGC141878, MGC141879) (Biotin)
Größe
£914.00
- SKU:
- 131309-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa543-651 from PIAS1 (NP_057250) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4A4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- PIAS1 functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. This protein plays a crucial role in transcriptional coregulation of various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway. It functions in testis as a nuclear receptor transcriptional coregulator and may have a role in androgen receptor initiation and maintenance of spermatogenesis. The effects of transcriptional coregulation, transactivation or silencing, may vary depending upon the biological context. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA sequence: LDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice