131304-HRP
PI4KB (PIK4CB, Phosphatidylinositol 4-kinase beta, PI4K-beta, PI4Kbeta, PtdIns 4-kinase beta, NPIK, PI4K92) (HRP)
Größe
£914.00
- SKU:
- 131304-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa731-829 from human PIK4CB with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3B1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish peroxidase (HRP).
- Weitere Details:
- Phosphoinositides are pivotal precursors to important second messengers and as signaling and molecules. Phosphatidylinositol 4-kinases (PI4Ks) are are crucial regulators of the phosphoinsitide cascade. PI4KCB is a wortmannin-sensitive PI 4-kinase responsible for regulating the synthesis of agonist-sensitive pools of polyphosphoinositides. The cellular reservoir of PI4KCB is predominantly cytosolic, however the protein is is activated strongly by recruitment to the membrane to stimulate phosphatidylinositol 4,5-bisphosphate synthesis at the plasma membrane. PI4KCB contains an N-terminal lipid kinase unique domain, which is shared by members of both the PI3 kinase and PI4 kinase families, and a C-terminal catalytic domain, which defines this protein as a member of a much larger protein/lipid kinase family. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: GGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice