131292
PHOX2A (Paired Mesoderm Homeobox Protein 2A, ARIX1 Homeodomain Protein, Aristaless Homeobox Protein Homolog, Paired-like Homeobox 2A, ARIX, PMX2A)
Größe
£685.00
- SKU:
- 131292
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-90 from human PHOX2A (NP_005160) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4F6
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Phox2a is a transcription factor expressed in noradrenergic cell types of the sympathetic nervous system. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice