Phospholipase C, gamma 1 (Phospholipase C-gamma-1, PLCgamma1, PLC-gamma-1, PLCg1, NCKAP3, 1-Phosphatidylinositol-4,5-bisphosphate Phosphodiesterase gamma-1, Phospholipase C-II, PLC-II, Phosphoinositide Phospholipase C-gamma-1, PLC1, PLC148, PLC-148)

Größe

£685.00

SKU:: 131290
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1192-1292 from human PLCG1 (NP_002651) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2A2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Phosphoinositide-specific phospholipase C (PLC) plays a significant role in transmembrane signaling. In response to extracellular stimuli such as hormones, growth factors and neurotransmitters, PLC hydrolyzes phosphatidylinositol 4,5-bisphosphate (PIP2) to generate two secondary messengers: inositol 1,4,5-triphosphate (IP3) and diacylglycerol (DAG). At least four families of PLCs have been identified: PLCb, PLCy, PLCd, and PLCe. Phosphorylation is one of the key mechanisms that regulate the activity of PLC. PLCy is activated by both receptor and non-receptor tyrosine kinases. PLCy forms a complex with EGF and PDGF receptors, which leads to the phosphorylation of PLCy at Tyr771, 783 and 1245. Phosphorylation by Syk at Tyr783 activates the enzymatic activity of PLCy1. PLCy2 is engaged in antigen-dependent signaling in B-cells and collagen-dependent signaling in platelets. Phosphorylation by Btk or Lck at Tyr753, 759, 1197 and 1217 is correlated with PLCy2 activity. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 40ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice