131290-HRP
Phospholipase C, gamma 1 (Phospholipase C-gamma-1, PLCgamma1, PLC-gamma-1, PLCg1, NCKAP3, 1-Phosphatidylinositol-4,5-bisphosphate Phosphodiesterase gamma-1, Phospholipase C-II, PLC-II, Phosphoinositide Phospholipase C-gamma-1, PLC1, PLC148, PLC-148) (HRP)
Größe
£914.00
- SKU:
- 131290-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1192-1292 from human PLCG1 (NP_002651) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2A2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Weitere Details:
- Phosphoinositide-specific phospholipase C (PLC) plays a significant role in transmembrane signaling. In response to extracellular stimuli such as hormones, growth factors and neurotransmitters, PLC hydrolyzes phosphatidylinositol 4,5-bisphosphate (PIP2) to generate two secondary messengers: inositol 1,4,5-triphosphate (IP3) and diacylglycerol (DAG). At least four families of PLCs have been identified: PLCb, PLCy, PLCd, and PLCe. Phosphorylation is one of the key mechanisms that regulate the activity of PLC. PLCy is activated by both receptor and non-receptor tyrosine kinases. PLCy forms a complex with EGF and PDGF receptors, which leads to the phosphorylation of PLCy at Tyr771, 783 and 1245. Phosphorylation by Syk at Tyr783 activates the enzymatic activity of PLCy1. PLCy2 is engaged in antigen-dependent signaling in B-cells and collagen-dependent signaling in platelets. Phosphorylation by Btk or Lck at Tyr753, 759, 1197 and 1217 is correlated with PLCy2 activity. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice