Phospholipase A2, Secretory, Group IB (PLA2G1B, phospholipase A2, MGC119834, MGC119835, Phosphatidylcholine 2-acylhydrolase, Phospholipase A2 precursor, PLA2, PLA2A, PPLA2)

Größe

£760.00

SKU:: 131288
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length human PLA2G1B, aa1-148 (NP_000919.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: PLA2G1B, hydrolyses the sn-2 ester bond of phospholipids, including those in cell membranes, to generate non-esterified free fatty acids and lysophospholipids. Most secretory PLA2s are stored in cytoplasmic granules and are released into plasma and biological fluids on appropriate cell activation, especially during systemic inflammatory, autoimmune, or allergic disease. PLA2G1B is abundant in digestive organs but is also found elsewhere. Human PLA2G1B shares 78-76aa sequence identity with mouse and rat PLA2G1B, respectively. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.