131279-APC

Phosphodiesterase 8A (PDE8A, High Affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic Phosphodiesterase 8A, FLJ16150, HsT19550) (APC)

Größe

£927.00

SKU:: 131279-APC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa32-122 from human PDE8A (NP_002596) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1H6
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: Phosphodiesterase 8A, a high affinity, cAMP-specific phosphodiesterase, has been implicated in penile erectile dysfunction. PDE8A activity is inhibited by dipyridamole, but not by rolipram, zaprinast, or IBMX. At least five splice variants and four protein isoforms have been reported. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.