PHF7 (PHD Finger Protein 7, Testis Development Protein NYD-SP6, DKFZp434L1850, HSPC045, HSPC226, MGC26088, NYD-SP6)

Größe

£685.00

SKU:: 131261
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa258-358 from human PHF7 (NP_057567) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1E9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May play a role in spermatogenesis. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GRDSFEDEGRWCLILCATCGSHGTHRDCSSLRSNSKKWECEECSPAAATDYIPENSGDIPCCSSTFHPEEHFCRDNTLEENPGLSWTDWPEPSLLEKPES Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.