PHB (Prohibitin)

Größe

£685.00

SKU:: 131232
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-273 from human PHB (AAH13401) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3F4-2B2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 1-10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVVFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAGDIAYQLSRSRNITYLPAGQSVLLQLPQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.