PFKM (6-phosphofructokinase, Muscle Type, Phosphofructokinase 1, Phosphohexokinase, Phosphofructo-1-kinase Isozyme A, PFK-A, Phosphofructokinase-M, PFKX, MGC8699)

Größe

£685.00

SKU:: 131191
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa681-781 from human PFKM (NP_000280) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1D1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Phosphofructokinase catalyzes the irreversible conversion of fructose 6 phosphate to fructose 1,6 bisphosphate. Mammalian PFK is a complex isozyme consisting of 3 subunits: muscle (M), liver (L), and platelet (P). Only M type PFK isozyme is expressed in mature muscle, while erythrocytes contain both L and M subunits. Defects in PFKM are the cause of glycogen storage disease type 7 (GSD7), also known as Tarui disease. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHITRKRSGEAAV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.