PET112L (Glutamyl-tRNA(Gln) Amidotransferase Subunit B, Mitochondrial, Glu-AdT Subunit B, Cytochrome C Oxidase Assembly Factor PET112 Homolog, PET112, HSPC199)

Größe

£685.00

SKU:: 131161
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa466-557 from human PET112L (NP_004555) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6B2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SAAKQVFEELWKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKKLS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.