131134
PEBP1 (Phosphatidylethanolamine-binding Protein 1, PEBP-1, HCNPpp, Neuropolypeptide h3, Prostatic-binding Protein, Raf Kinase Inhibitor Protein, RKIP, PBP, PEBP)
Größe
£685.00
- SKU:
- 131134
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-188 from human PBP (AAH31102) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1D3-1B6
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- PBP binds ATP, opioids and phosphatidylethanolamine, exhibiting a lower affinity for phosphatidylinositol and phosphatidylcholine. This serine protease inhibitor inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase. PBP contains hippocampal cholinergic neurostimulating peptide (HCNP), which may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice