PDZD8 (PDZ Domain-containing Protein 8, Sarcoma Antigen NY-SAR-84/NY-SAR-104, PDZK8, bA129M16.2, FLJ25412, FLJ34427)

Größe

£685.00

SKU:: 131131
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa949-1059 from human PDZD8 (NP_776152) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4E3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Plays a role in the regulation of cell morphology and cytoskeletal organization. May inhibit herpes simplex virus 1 infection at an early stage. May promote retroviral infection. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RQVSKTRLSEPGTDLVEPSPKHTPNTSDNEGSDTEVCGPNSPSKRGNSTGIKLVRKEGGLDDSVFIAVKEIGRDLYRGLPTEERIQKLEFMLDKLQNEIDQELEHNNSLV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.