131122-ML490
PDXK (Pyridoxal Kinase, Pyridoxine Kinase, C21orf97, C21orf124, DKFZp566A071, FLJ31940, FLJ37311, MGC15873, MGC31754, MGC52346, PKH, PNK, PRED79) (MaxLight 490)
Größe
£914.00
- SKU:
- 131122-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full-length recombinant protein corresponding to aa1-312 from PDXK with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4G6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Pyridoxal kinase (PDXK) converts vitamin B6 to pyridoxal-5-phosphate (PLP), an essential cofactor in the intermediate metabolism of amino acids and neurotransmitters. The PDXK gene encodes a 312aa polypeptide, and expression of the cDNA reveals pyridoxal kinase activity. Northern blot analysis revealed that a major 1.5-kb PDXK transcript is expressed in all tissues tested. The expression of PDXK shows circadian oscillations. The expression of Pdxk in mouse liver and brain is regulated by the 3 PAR bZIP transcription factors, Dbp, Hlf, and Tef, which also show circadian oscillations in expression. Mice devoid of all 3 transcription factors show decreased levels of brain PLP, serotonin, and dopamine, and are highly susceptible to frequently lethal generalized spontaneous and audiogenic epilepsies. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice