131115-APC
PDX1 (Pancreas/Duodenum Homeobox Protein 1, PDX-1, Glucose-sensitive Factor, GSF, Insulin Promoter Factor 1, IPF-1, Insulin Upstream Factor 1, IUF-1, Islet/Duodenum Homeobox-1, IDX-1, Somatostatin-transactivating Factor 1, STF-1, IPF1, STF1) (APC)
Größe
£927.00
- SKU:
- 131115-APC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Recombinant corresponding to aa109-208 from human IPF1 (NP_000200) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3F10
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- PDX1, also known as Pancreas/duodenum homeobox protein 1, is a nuclear protein belonging to the Antp homeobox family and IPF1/XlHbox-8 subfamily with a homeobox DNA-binding domain. It activates insulin, somatostatin, glucokinase, islet amyloid polypeptide and glucose transporter type 2 gene transcription and is particularly involved in glucose-dependent regulation of insulin gene transcription. During development, PDX1 specifies the early pancreatic epithelium, permitting its proliferation, branching and subsequent differentiation. Expression is common in duodenum and pancreas (Langerhans islet beta cells and small subsets of endocrine non-beta-cells, at low levels in acinar cells). Defects in PDX1 are associated with pancreatic agenesis, maturity onset diabetes noninsulin-dependent diabetes mellitus (NIDDM), also known as diabetes mellitus type II, and maturity onset diabetes of the young type 4 (MODY4). Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice