PDIK1L (Serine/Threonine-protein Kinase PDIK1L, PDLIM1-interacting Kinase 1-like, PDIK1L, CLIK1L, RP11-96L14.4, STK35L2)

Größe

£685.00

SKU:: 131088
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1-100 from human PDIK1L (NP_690048) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4B7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: PDIK1L is expressed in liver, kidney, pancreas, spleen, thymus and prostate, contains 1 protein kinase domain which belongs to the Ser/Thr protein kinase family. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVSSQPKYDLIREVGRGSYGVVYEAVIRKTSARVAVKKIRCHAPENVELALREFWALSSIKSQHPNVIHLEECILQKDGMVQKMSHGSNSSLYLQLVET Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.