131088-FITC

PDIK1L (Serine/Threonine-protein Kinase PDIK1L, PDLIM1-interacting Kinase 1-like, PDIK1L, CLIK1L, RP11-96L14.4, STK35L2) (FITC)

Größe

£914.00

SKU:: 131088-FITC
Anwendung:: FLISA
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1-100 from human PDIK1L (NP_690048) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4B7
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Weitere Details:: PDIK1L is expressed in liver, kidney, pancreas, spleen, thymus and prostate, contains 1 protein kinase domain which belongs to the Ser/Thr protein kinase family. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVSSQPKYDLIREVGRGSYGVVYEAVIRKTSARVAVKKIRCHAPENVELALREFWALSSIKSQHPNVIHLEECILQKDGMVQKMSHGSNSSLYLQLVET Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.