PDIA5 (Protein Disulfide-isomerase A5, Protein Disulfide Isomerase-related Protein, PDIR)

Größe

£685.00

SKU:: 131085
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa31-131 from human PDIA5 (NP_006801) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3A3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: PDIR (Protein disulfide isomerase related)are endoplasmic reticulum (ER) resident proteins that catalyzse formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: ERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.