131065-BIOTIN

PDGFD (Platelet-derived Growth Factor D, PDGF-D, Iris-expressed Growth Factor, Spinal Cord-derived Growth Factor B, SCDGF-B, IEGF, SCDGFB, MSTP036, UNQ1899/PRO4345, MGC26867) (Biotin)

Größe

£914.00

SKU:: 131065-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa24-123 from human PDGFD with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4H2
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: The platelet-derived growth factor (PDGF) family consists of four disulfide-linked homodimers and one heterodimer (PDGF-AB). These proteins regulate diverse cellular functions through interactions with PDGF Ra and Rb. Mature PDGF-DD associates with PDGF Rb and triggers signaling through PDGF Rb homodimers and PDGF Ra/b heterodimers. The human PDGF-DD cDNA encodes a 370aa precursor that includes a 23aa signal sequence, one CUB domain, and one PDGF/VEGF domain. The PDGF/VEGF domain shares 27-35aa sequence identity with the corresponding regions of other PDGF family members. Human PDGF-DD shares 87aa sequence identity with mouse and rat PDGF-DD. PDGF-DD is secreted as a100kD latent homodimer which is activated by proteolysis to release a 35kD bioactive protein containing the PDGF/VEGF homology domain. A splice variant of PDGF-DD has a 6aa deletion near the N-terminus. A 72aa deletion within the PDGF/VEGF domain generates an inactive protein in mouse but has not been detected in human. PDGF-DD is widely expressed in embryonic and adult tissues, and PDGF Rb is expressed in a generally complementary pattern. PDGF-DD functions as a growth factor for renal artery smooth muscle cells and lens epithelial cells, and as a macrophage chemoattractant. PDGF-DD is overexpressed in and contributes to several disease states, including renal and hepatic fibrosis, mesangial proliferative glomerulopathy, pulmonary lymphoid infiltration, and many cancers. PDGF-DD functions in both paracrine and autocrine manners. Applications: Suitable for use in ELISA and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TPQSASIKALRNANLRRDDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDISETSTIIRGR Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice