131048-BIOTIN

PDE3B (cGMP-inhibited 3',5'-cyclic Phosphodiesterase B, CGIPDE1, Cyclic GMP-inhibited Phosphodiesterase B) (Biotin)

Größe

£914.00

SKU:: 131048-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa401-501 from human PDE3B with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4A4
Format:: Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Biotin.
Weitere Details:: Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes; PDE3B may play a role in fat metabolism. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: LTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTH Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.