131048-APC

PDE3B (cGMP-inhibited 3',5'-cyclic Phosphodiesterase B, CGIPDE1, Cyclic GMP-inhibited Phosphodiesterase B) (APC)

Größe

£927.00

SKU:: 131048-APC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa401-501 from human PDE3B with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4A4
Format:: Supplied as a liquid in PBS, pH 7.4. Labeled with Allophycocyanin (APC).
Weitere Details:: Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes; PDE3B may play a role in fat metabolism. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: LTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTH Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.