131047-ML490
PDE3A (cGMP-inhibited 3',5'-cyclic Phosphodiesterase A, Cyclic GMP-inhibited Phosphodiesterase A, CGI-PDE A) (MaxLight 490)
Größe
£914.00
- SKU:
- 131047-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa533-640 from human PDE3A (NP_000912) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 5C12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Phosphodiesterase 3A is a cGMP inhibited, cAMP/cGMP dual-specific phosphodiesterase. PDE3A has been implicated in male erectile dysfunction, mammalian oocyte maturation, platelet function, vascular smooth muscle function, and salivary gland tumors. Three alternatively spliced transcripts have been reported. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: TPASSLVSKISAVQFPESADTTAKQSLGSHRALTYTQSAPDLSPQILTPPVICSSCGRPYSQGNPADEPLERSGVATRTPSRTDDTAQVTSDYETNNNSDSSDIVQNE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice