131047-APC

PDE3A (cGMP-inhibited 3',5'-cyclic Phosphodiesterase A, Cyclic GMP-inhibited Phosphodiesterase A, CGI-PDE A) (APC)

Größe

£927.00

SKU:: 131047-APC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa533-640 from human PDE3A (NP_000912) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5C12
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: Phosphodiesterase 3A is a cGMP inhibited, cAMP/cGMP dual-specific phosphodiesterase. PDE3A has been implicated in male erectile dysfunction, mammalian oocyte maturation, platelet function, vascular smooth muscle function, and salivary gland tumors. Three alternatively spliced transcripts have been reported. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: TPASSLVSKISAVQFPESADTTAKQSLGSHRALTYTQSAPDLSPQILTPPVICSSCGRPYSQGNPADEPLERSGVATRTPSRTDDTAQVTSDYETNNNSDSSDIVQNE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.