131046-ML650
PDE2A (cGMP-dependent 3',5'-cyclic Phosphodiesterase, Cyclic GMP-stimulated Phosphodiesterase, CGS-PDE, cGSPDE) (MaxLight 650)
Größe
£914.00
- SKU:
- 131046-ML650
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa850-940 from human PDE2A (NP_002590) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4F4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Weitere Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Phosphodiesterase 2A is a cGMP stimulated, cAMP/cGMP dual-specific phosphodiesterase whose hydrolytic activity is stimulated by the presence of cGMP binding to the GAF domain. PDE2A has been implicated in penile erectile dysfunction and in the regulation of fluid and inflammatory cell transit across the endothelial cell barrier (i.e., venous and capillary). PDE2A activity is inhibited by erythro-9-(2-hydroxyl-3-nonyl)adenine (EHNA). At least three isoforms have been reported (PDE2A1, PDE2A2, and PDE2A3). Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: REKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice