131027-BIOTIN
PDAP1 (28kD Heat-and Acid-stable Phosphoprotein, PDGF-associated Protein, PAP, PDGFA-associated Protein 1, PAP1, HASPP28) (Biotin)
Größe
£914.00
- SKU:
- 131027-BIOTIN
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full-length recombinant protein corresponding to aa1-181 from PDAP1 (AAH00684) with GST tag. *MW of the GST tag alone is 26kD.
- Klon:
- 3B10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Human PDAP1 encodes a deduced 181aa protein expressed in all tissues test with the exception of liver, most abundantly in brain. PDAP1 enhances PDGFA-stimulated cell growth in mouse fibroblasts, but inhibits the mitogenic effect of PDGFB. The binding between PDGFA and PDAP1 is a low affinity/high capacity interaction, as determined by sold-phase studies. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice