PCSK2 (Neuroendocrine Convertase 2, NEC 2, KEX2-like Endoprotease 2, Prohormone Convertase 2, Proprotein Convertase 2, PC2, NEC2)

Größe

£685.00

SKU:: 131010
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa501-609 from human PCSK2 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3H4
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: PCSK2 belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This protein is a proinsulin-processing enzyme that plays a key role in regulating insulin biosynthesis. The protein is also known to cleave proopiomelanocortin, proenkephalin, prodynorphin and proluteinizing-hormone-releasing hormone. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYIDQVVRDYQS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.