131006
PCSK1 (Neuroendocrine Convertase 1, NEC 1, Prohormone Convertase 1, Proprotein Convertase 1, PC1, NEC1)
Größe
£685.00
- SKU:
- 131006
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa652-754 from human PCSK1 (NP_000430) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3D2
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- PCSK1 is a Serine S8 type protease. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 30ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: GGRRDELEEGAPSEAMLRLLQSAFSKNSPPKQSPKKSPTAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTKPYKHRDDRLLQALVDILNEEN Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice