MED15 (PCQAP, Mediator of RNA Polymerase II Transcription Subunit 15, Mediator Complex Subunit 15, Positive Cofactor 2 Glutamine/Q-rich-associated Protein, PC2 Glutamine/Q-rich-associated Protein, TPA-inducible Gene 1 Protein, TIG-1, Activator-recruited Cofactor 105kD Component, ARC105, CTG rEpeat Protein 7a, Trinucleotide Repeat-containing Gene 7 Protein, ARC105, CTG7A, TIG1, TNRC7, DKFZp686A2214, DKFZp762B1216, FLJ42282, FLJ42935)

Größe

£685.00

SKU:: 131005
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-89 from human PCQAP (NP_056973) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4A4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: PCQAP is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSL* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.