PCBD1 (DCOH, PCBD, Pterin-4-alpha-carbinolamine Dehydratase, 4-alpha-hydroxy-tetrahydropterin Dehydratase, Dimerization Cofactor of Hepatocyte Nuclear Factor 1-alpha, Phenylalanine Hydroxylase-stimulating Protein, Pterin Carbinolamine Dehydratase)

Größe

£685.00

SKU:: 130926
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-105 from human PCBD1 (AAH06324) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1G11-H5
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: PCBD1 encodes pterin-4 alpha-carbinolamine dehydratase, an enzyme involved in phenylalanine hydroxylation. A deficiency of this enzyme leads to hyperphenylalaninemia. The enzyme regulates the homodimerization of the transcription factor hepatocyte nuclear factor 1 (HNF1). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.