PBX1 (Pre-B Cell Leukemia Transcription Factor 1, Homeobox Protein PBX1, Homeobox Protein PRL, PRL, DKFZp686B09108, MGC126627)

Größe

£685.00

SKU:: 130919
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa213-322 from human PBX1 (NP_002576) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4A2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: PBX1 binds the sequence 5'-ATCAATCAA-3'. It acts as a transcriptional activator of PF4 in complex with MEIS1, and is converted into a potent transcriptional activator by the (1;19) translocation. It may have a role in steroidogenesis and, subsequently, sexual development and differentiation. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.