130919-FITC
PBX1 (Pre-B Cell Leukemia Transcription Factor 1, Homeobox Protein PBX1, Homeobox Protein PRL, PRL, DKFZp686B09108, MGC126627) (FITC)
Größe
£914.00
- SKU:
- 130919-FITC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa213-322 from human PBX1 (NP_002576) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4A2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- PBX1 binds the sequence 5'-ATCAATCAA-3'. It acts as a transcriptional activator of PF4 in complex with MEIS1, and is converted into a potent transcriptional activator by the (1;19) translocation. It may have a role in steroidogenesis and, subsequently, sexual development and differentiation. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice