130919-BIOTIN
PBX1 (Pre-B Cell Leukemia Transcription Factor 1, Homeobox Protein PBX1, Homeobox Protein PRL, PRL, DKFZp686B09108, MGC126627) (Biotin)
Größe
£914.00
- SKU:
- 130919-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa213-322 from human PBX1 (NP_002576) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4A2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- PBX1 binds the sequence 5'-ATCAATCAA-3'. It acts as a transcriptional activator of PF4 in complex with MEIS1, and is converted into a potent transcriptional activator by the (1;19) translocation. It may have a role in steroidogenesis and, subsequently, sexual development and differentiation. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice