PAX5 (Paired Box Protein Pax-5, B Cell-specific Transcription Factor, BSAP, PAX-5)

Größe

£685.00

SKU:: 130905
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa192-301 from human PAX5 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 8F9
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: May play an important role in B-cell differentiation as well as neural development and spermatogenesis. Involved in the regulation of the CD19 gene, a B-lymphoid-specific target gene. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (FFPE): 1.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: ADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.