PARD3B (Partitioning Defective 3 Homolog B, Amyotrophic Lateral Sclerosis 2 Chromosomal Region Candidate Gene 19 Protein, PAR3-beta, Partitioning Defective 3-like Protein, PAR3-L Protein, ALS2CR19, PAR3B, PAR3L, MGC16131)

Größe

£685.00

SKU:: 130875
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa101-210 from human ALS2CR19 (NP_689739) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 8D7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Putative adapter protein involved in asymmetrical cell division and cell polarization processes. May play a role in the formation of epithelial tight junctions. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SPDAFETEVAAQLAAFKPIGGEIEVTPSALKLGTPLLVRRSSDPVPGPPADTQPSASHPGGQSLKLVVPDSTQNLEDREVLNGVQTELLTSPRTKDTLSDMTRTVEISG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.