PARD3 (Partitioning Defective 3 Homolog, PAR-3, PARD-3, Atypical PKC Isotype-specific-interacting Protein, ASIP, CTCL Tumor Antigen se2-5, PAR3-alpha, PAR3, PAR3A, Bazooka, FLJ21015, SE2-5L16, SE2-5LT1, SE2-5T2)

Größe

£685.00

SKU:: 130874
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa181-290 from human PARD3 (AAH11711) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4G5
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Adapter protein involved in asymmetrical cell division and cell polarization processes. Seems to play a central role in the formation of epithelial tight junctions. Targets the phosphatase PTEN to cell junctions. Association with PARD6B may prevent the interaction of PARD3 with F11R/JAM1, thereby preventing tight junction assembly. The PARD6-PARD3 complex links GTP-bound Rho small GTPases to atypical protein kinase C proteins. Required for establishment of neuronal polarity and normal axon formation in cultured hippocampal neurons. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNRSTPS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.