PAQR5 (Membrane Progestin Receptor gamma, mPR gamma, Progestin and adipoQ Receptor Family Member 5, Progestin and adipoQ Receptor Family Member V, MPRG, FLJ20190)

Größe

£685.00

SKU:: 130869
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-51 from human PAQR5 (NP_060175) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1F4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Steroid membrane receptor. Binds progesterone. May be involved in oocyte maturation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ESGVAAAREECLVSGLPVLSPRPVHWTPETLGTQDTIGETGHFTKDLTGM* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.