PANK4 (Pantothenate Kinase 4, hPanK4, Pantothenic Acid Kinase 4, DKFZp547M242, FLJ10782)

Größe

£685.00

SKU:: 130860
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa673-773 from human PANK4 (NP_060686) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4F10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Plays a role in the physiological regulation of the intracellular CoA concentration. Applications: Suitable for use in ELISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AGMDPVVHSALQEERLLLVQTGSSSPCLDLSRLDKGLAALVRERGADLVVIEGMGRAVHTNYHAALRCESLKLAVIKNAWLAERLGGRLFSVIFKYEVPAE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.