PAK2 (Serine/Threonine-protein Kinase PAK 2, Gamma-PAK, PAK65, S6/H4 Kinase, p21-activated Kinase 2, PAK-2, p58)

Größe

£685.00

SKU:: 130844
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa131-230 from human PAK2 (NP_002568) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1E1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The PAK (p21-activated kinase) family of serine/threonine kinases plays an important role in multiple cellular processes, including cytoskeletal reorganization, MAPK signaling, apoptotic signaling, etc. Binding of Rac/cdc42 to the CRIB (or PBD) domain at the N-terminal region of PAK causes autophosphorylation and conformational change of PAK. Phosphorylation of Ser21 of PAK1 or Ser20 of PAK2 regulates its binding with the adaptor protein Nck. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.