130841-APC
PAK1 (Serine/Threonine-protein Kinase PAK 1, Alpha-PAK, p21-activated Kinase 1, PAK-1, p65-PAK, MGC130000, MGC130001) (APC)
Größe
£927.00
- SKU:
- 130841-APC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa191-280 from human PAK1 (NP_002567) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4D1
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- PAK1 belongs to a highly conserved family of serine-threonine protein kinases that interact specifically with the Rho-family GTPases Cdc42 (cell division cycle 42), Rac and the recently described Cdc42 homologous protein, Chp. PAK proteins participate in regulating the actin cytoskeleton, focal adhesion contacts and cell motility, and are implicated in other cellular functions, such as activation of MAPK (mitogen-activated protein kinase) pathways, apoptotic/survival signalling, cellular transformation and HIV pathogenesis. PAK1 protein plays an important role in regulating cell motility and morphology. Human PAK1 gene is localized on chromosomal region 11q13-q14. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 35ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: APRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice