130836
PAI2 (Plasminogen Activator Inhibitor 2, PAI-2, Placental Plasminogen Activator Inhibitor, Monocyte Arg-serpin, Urokinase Inhibitor, Serpin B2, PLANH2, SERPINB2)
Größe
£685.00
- SKU:
- 130836
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-100 from human SERPINB2 (AAH12609) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3A9
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- PAI2 inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAVTPMTPENFTSCGFMQQIQKGSYPDAILQAQAA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice