RHOXF1 (OTEX, PEPP1, Rhox Homeobox Family Member 1, Ovary-, Testis- and Epididymis-expressed Gene Protein, Paired-like Homeobox Protein PEPP-1, MGC119030, MGC119033)

Größe

£685.00

SKU:: 130766
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1-110 from human OTEX (NP_644811) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4D12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: RHOXF1 may be a transcription factor involved in reproductive processes. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MARSLVHDTVFYCLSVYQVKISPTPQLGAASSAEGHVGQGAPGLMGNMNPEGGVNHENGMNRDGGMIPEGGGGNQEPRQQPQPPPEEPAQAAMEGPQPENMQPRTRRTKF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.