130718-BIOTIN
OMP (Olfactory Marker Protein, Olfactory Neuronal-specific Protein) (Biotin)
Größe
£914.00
- SKU:
- 130718-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa65-163 from human OMP with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2B7
- Format:
- Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Biotin.
- Weitere Details:
- Olfactory marker protein (OMP) is an abundant, 19kD, cytosolic protein that is almost exclusively expressed in mature, functioning, olfactory neurons but not in the neural precursor basal cells. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human. Its tissue-specific expression in the receptor cells together with the results of the mouse knockout studies show that OMP represents a novel modulatory component of the odor detection/signal transduction cascade. May act as a modulator of the olfactory signal-transduction cascade. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: FERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice